KEGG   Gloeobacter kilaueensis: GKIL_3845
Entry
GKIL_3845         CDS       T02885                                 
Name
(GenBank) two component transcriptional regulator, winged helix family
  KO
K07776  two-component system, OmpR family, response regulator RegX3
Organism
glj  Gloeobacter kilaueensis
Pathway
glj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:glj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GKIL_3845
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:glj02022]
    GKIL_3845
Two-component system [BR:glj02022]
 OmpR family
  SenX3-RegX3 (phosphate starvation response)
   GKIL_3845
SSDB
Motif
Pfam: Trans_reg_C Response_reg PDE8A_N
Other DBs
NCBI-ProteinID: AGY60091
UniProt: U5QME5
LinkDB
Position
4061953..4062657
AA seq 234 aa
MGTRVLVVEDDDEIAQLIELYCRQEGFEPRRVNNGLAALRIVESDCPEVIILDWMLPGLD
GLEVCQRIRALPAGKDPYILMLTARGEEIDRIVGLSTGADDYVVKPFSPMELMARIRALL
RRSQRQNSGEVSTSKLQSPHFLLDCDRRIASREDQPLELTTLEFDLLVALIAQPGRVWTR
NQLISRLWGDDFFGDERVVDTHIARLRKKIEPDPARPQHLKTVIGVGYKFEDHE
NT seq 705 nt   +upstreamnt  +downstreamnt
atgggaactcgcgtactggttgtcgaggacgacgacgagattgcccaactcatcgagctg
tactgccgacaagaaggttttgaaccgcgccgggtcaacaatggccttgctgccctgcgc
atcgtcgagagcgactgcccggaggtgattattctcgattggatgctgccggggctcgat
ggcctggaagtctgccagcgcatccgggccttaccggcgggcaaagacccctatatcctg
atgctcaccgccaggggtgaagagatcgaccggatcgtcgggctttcgaccggggccgac
gattacgtcgtcaagccttttagcccgatggagttgatggcccgcatccgggcgctgttg
cgccgctcccagcgccagaacagtggcgaggtgtccaccagcaagctgcagtcgccgcac
tttttgctcgactgcgaccggcgcatcgccagccgcgaagaccagccccttgaactgacg
accctcgaattcgatctgctcgtcgctcttattgcccagccgggccgggtctggacgcgc
aaccagcttatcagccgcctgtggggagatgatttttttggcgacgagcgggtggtcgat
acccacatcgcccggctgcgcaaaaagatcgaacccgatccggcccggccccagcacctc
aagacggtgatcggcgtcggttacaagtttgaggaccatgaatag

DBGET integrated database retrieval system