Gloeobacter kilaueensis: GKIL_3973 Help Entry GKIL_3973         CDS       T02885                                  Symbol hit Name (GenBank) histidine triad (HIT) protein   KO K02503   histidine triad (HIT) family protein [EC:3.9.1.-] Organism glj  Gloeobacter kilaueensis Brite KEGG Orthology (KO) [BR:glj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:glj03016]     GKIL_3973 (hit)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:glj04147]     GKIL_3973 (hit) Transfer RNA biogenesis [BR:glj03016]  Eukaryotic type   Aminoacyl-tRNA synthetases (AARSs)    AARS associated factors     GKIL_3973 (hit) Exosome [BR:glj04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    GKIL_3973 (hit) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HIT DcpS_C Motif Other DBs NCBI-ProteinID:  AGY60219 UniProt:  U5QRE1 LinkDB All DBs Position complement(4177972..4178316) Genome browser AA seq 114 aa AA seqDB search MSTDTIFGKILRKEIPAQIVFEDEQCLAFRDVNPQAPVHILIIPKKPLPQIEQMSAQDEG LVGHLFFVATEIARREGLGTGYRLLINNGPDGGQTVYHLHLHLLGGRPFGWPPG NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgagcaccgacactatcttcggcaaaattctgcgcaaggagatcccggcccagatcgtc tttgaagacgagcagtgcctcgcttttcgcgacgtcaatccccaggctccggtgcatatt ctgatcatccccaaaaagcccctccctcagatcgaacagatgagcgcccaggacgagggg ctcgtgggccacctgttctttgtcgccaccgagatcgcccgccgcgaaggactgggcacc ggctatcgcctgcttatcaacaacggtcctgacggcggccagaccgtctaccacctgcac ctgcacctgctcggtggccgccccttcggctggccgccggggtaa

DBGET integrated database retrieval system