Trichlorobacter lovleyi: Glov_1935 Help Entry Glov_1935         CDS       T00708                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism glo  Trichlorobacter lovleyi Pathway glo01100   Metabolic pathways glo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:glo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Glov_1935    00074 Mycolic acid biosynthesis     Glov_1935   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Glov_1935 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF1896 Ribosomal_L50 CEP76_N HLH Motif Other DBs NCBI-ProteinID:  ACD95651 UniProt:  B3E2J4 LinkDB All DBs Position complement(2061126..2061359) Genome browser AA seq 77 aa AA seqDB search MSDVAKRVKEIIAEQLGVDEAQAVSEASFMDDLGADSLDTVELVMALEEEFDIEIPDEDA EKIQTVQDAIDYITEHT NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgtctgatgtagctaaaagagtaaaagaaattatcgccgagcagctgggagttgacgag gcacaggctgtttccgaggcatccttcatggatgatctgggtgcagactcccttgacacc gttgagctggttatggctcttgaagaggaattcgatattgagatccccgatgaggatgct gagaagatccagaccgttcaggatgctattgattacatcactgagcacacctag

DBGET integrated database retrieval system