Trichlorobacter lovleyi: Glov_2419 Help Entry Glov_2419         CDS       T00708                                  Name (GenBank) phosphopantetheine-binding   KO K02078   acyl carrier protein Organism glo  Trichlorobacter lovleyi Pathway glo01100   Metabolic pathways glo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:glo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Glov_2419    00074 Mycolic acid biosynthesis     Glov_2419   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Glov_2419 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ACD96135 UniProt:  B3E5P4 LinkDB All DBs Position complement(2594586..2594852) Genome browser AA seq 88 aa AA seqDB search MNREQACAEVSAILHELLPGSGPVFQAQQHLQRDLGIDSIRFVQLVLALEDRLTIAIDDA DLFRLRSVGDCVDLVMERLPHVGGERGV NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgaacagggagcaggcctgtgctgaggttagcgccattctgcatgagctgctgcccggc agcggcccggtatttcaggcacagcaacacctgcagcgtgatcttggcattgactcaatc cggtttgtgcagctggtgcttgccctggaagaccgcttgacaattgcaatcgatgatgca gatcttttcaggctgcggtctgtgggagactgtgttgatctggttatggagcggctgccg cacgtgggtggcgagaggggcgtatga

DBGET integrated database retrieval system