Gloeocapsa sp. PCC 7428: Glo7428_1371 Help Entry Glo7428_1371      CDS       T02400                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism glp  Gloeocapsa sp. PCC 7428 Pathway glp01100   Metabolic pathways glp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:glp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Glo7428_1371    00074 Mycolic acid biosynthesis     Glo7428_1371   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Glo7428_1371 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Ribosomal_L50 TerB Motif Other DBs NCBI-ProteinID:  AFZ29938 LinkDB All DBs Position 1513725..1513976 Genome browser AA seq 83 aa AA seqDB search MSEAEILEKVKKIVTEQLSVEAEKVTPAANFANDLGADSLDVVELVMALEEEFDIEIPDE AAEQITTVQQAVDYISNKVTASA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagcgaagcggaaattttagagaaagtcaagaaaattgtgactgagcaactcagtgta gaagccgaaaaggtaacgccagccgcgaactttgcgaatgacctaggggctgattcgctc gatgttgttgaactcgtgatggctttagaggaagaattcgatattgaaatccccgatgag gcagcagaacagattacaacggtacaacaagcggtagattatatcagtaacaaagtgaca gcatcggcttag

DBGET integrated database retrieval system