Glarea lozoyensis: GLAREA_08512 Help Entry GLAREA_08512      CDS       T04883                                  Name (RefSeq) RNA polymerase subunit RPB10   KO K03007   DNA-directed RNA polymerases I, II, and III subunit RPABC5 Organism glz  Glarea lozoyensis Pathway glz03020   RNA polymerase glz03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:glz00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     GLAREA_08512   09124 Replication and repair    03420 Nucleotide excision repair     GLAREA_08512  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:glz03021]     GLAREA_08512    03400 DNA repair and recombination proteins [BR:glz03400]     GLAREA_08512 Transcription machinery [BR:glz03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      GLAREA_08512   RNA polymerase III system    RNA polymerase III      GLAREA_08512   RNA polymerase I system    RNA polymerase I      GLAREA_08512 DNA repair and recombination proteins [BR:glz03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       GLAREA_08512 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_N Chordopox_RPO7 Motif Other DBs NCBI-GeneID:  19467560 NCBI-ProteinID:  XP_008088747 UniProt:  S3CH86 LinkDB All DBs Position Unknown AA seq 75 aa AA seqDB search MIIPVRCFSCGKVVGDLWERYLKLIDEGIPDGDAMDQLGCKRYCCRRMIMTHVDLIEKLL KYNPAERDMKKQALN NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgattattccagttcgctgcttttcctgcgggaaggttgttggggatttatgggaacgg tacttgaagttgattgatgagggtattccagatggagatgctatggaccaacttggatgc aaacgatactgttgtcgccgcatgatcatgacccacgtcgacctcattgagaaactcctc aaatacaatcccgcggaacgagacatgaagaagcaagctctcaactag

DBGET integrated database retrieval system