Glarea lozoyensis: GLAREA_10261 Help Entry GLAREA_10261      CDS       T04883                                  Name (RefSeq) Skp1 dimerization   KO K03094   S-phase kinase-associated protein 1 Organism glz  Glarea lozoyensis Pathway glz03083   Polycomb repressive complex glz04111   Cell cycle - yeast glz04120   Ubiquitin mediated proteolysis glz04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:glz00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     GLAREA_10261    04120 Ubiquitin mediated proteolysis     GLAREA_10261   09126 Chromosome    03083 Polycomb repressive complex     GLAREA_10261  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     GLAREA_10261  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:glz04131]     GLAREA_10261    04121 Ubiquitin system [BR:glz04121]     GLAREA_10261    03036 Chromosome and associated proteins [BR:glz03036]     GLAREA_10261 Membrane trafficking [BR:glz04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     GLAREA_10261 Ubiquitin system [BR:glz04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      GLAREA_10261    Cul7 complex      GLAREA_10261 Chromosome and associated proteins [BR:glz03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      GLAREA_10261   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      GLAREA_10261 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ Trnau1ap Motif Other DBs NCBI-GeneID:  19469308 NCBI-ProteinID:  XP_008078502 UniProt:  S3D7S4 LinkDB All DBs Position Unknown AA seq 167 aa AA seqDB search MSEGPAQTIVLQSNDNVAITVERKVAERSMLIKNMLEDLAGSELDSAIPIPNVNESVLKK VIEWCEHHKNDPQTAADDDSDSRKKTTDIEEWDQKFMQVDQEMLFEIILASNYLDIKPLL DVGCKTVANMIKGKSPEEIRKTFNITNDFTPEEEEQIRRENEWAEDR NT seq 504 nt NT seq  +upstreamnt  +downstreamnt atgtctgaaggtccagcacaaacgatcgttctccagtcaaatgacaatgttgccatcact gttgaacgcaaagttgctgagcgatcaatgttgatcaagaatatgcttgaggatcttgct ggcagcgagctcgactctgccatccccattcccaatgtcaacgagtctgtcctgaagaag gtcatcgaatggtgcgagcaccacaagaacgatccacaaaccgccgccgatgacgattcc gattcgcgcaagaagaccactgatattgaggagtgggatcagaagttcatgcaagtcgac caggagatgctctttgagatcattctcgcttccaactacctcgacatcaagccacttttg gatgtcggatgcaagaccgtcgcaaacatgatcaagggcaagtccccagaagagatccga aagacattcaacatcaccaacgacttcactcctgaggaggaggagcaaatccgccgcgag aacgagtgggccgaggatcgttaa

DBGET integrated database retrieval system