Glarea lozoyensis: GLAREA_10650 Help Entry GLAREA_10650      CDS       T04883                                  Name (RefSeq) Nucleic acid-binding protein   KO K03016   DNA-directed RNA polymerases I, II, and III subunit RPABC3 Organism glz  Glarea lozoyensis Pathway glz03020   RNA polymerase glz03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:glz00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     GLAREA_10650   09124 Replication and repair    03420 Nucleotide excision repair     GLAREA_10650  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:glz03021]     GLAREA_10650    03400 DNA repair and recombination proteins [BR:glz03400]     GLAREA_10650 Transcription machinery [BR:glz03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      GLAREA_10650   RNA polymerase III system    RNA polymerase III      GLAREA_10650   RNA polymerase I system    RNA polymerase I      GLAREA_10650 DNA repair and recombination proteins [BR:glz03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       GLAREA_10650 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb8 RNA_pol_RpbG Motif Other DBs NCBI-GeneID:  19469696 NCBI-ProteinID:  XP_008077942 UniProt:  S3DB38 LinkDB All DBs Position Unknown AA seq 148 aa AA seqDB search MATAGDTQLFDENIEINGLDDKKYDRVCRLSGTSLDGSIAIKLDINSQIYPCAVGDQIRV VLATSLSLDGSKDDGKGWRDIARSDAESTMADMFDYVCHGKIYKFEDVENGDSIKCFISF GGLLMAIEGPFKKLTSLRVDYVYLLMKK NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggccaccgcaggtgacacccagctcttcgacgaaaacattgaaatcaatggactcgac gacaagaaatacgaccgtgtctgtcgactttctggcacttctttagacggttcaattgct atcaagcttgacattaattcacaaatatacccatgcgcggttggcgatcaaatccgagta gttcttgcgacaagcttgagtttagatggtagtaaggatgatggcaagggatggagggat attgcaaggtcggatgcggaatccacgatggctgatatgttcgactatgtctgccatggc aagatctacaagtttgaggatgtggaaaatggcgattcgataaaatgtttcatatcattt ggtggacttcttatggctatcgaagggccatttaagaagctcacttcactgcgagttgat tatgtatatcttctcatgaagaaatag

DBGET integrated database retrieval system