Granulicella mallensis: AciX8_2794 Help Entry AciX8_2794        CDS       T01664                                  Name (GenBank) helix-turn-helix Fis-type   KO K03557   Fis family transcriptional regulator, factor for inversion stimulation protein Organism gma  Granulicella mallensis Brite KEGG Orthology (KO) [BR:gma00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:gma03000]     AciX8_2794    03036 Chromosome and associated proteins [BR:gma03036]     AciX8_2794    03400 DNA repair and recombination proteins [BR:gma03400]     AciX8_2794 Transcription factors [BR:gma03000]  Prokaryotic type   Helix-turn-helix    Other families     AciX8_2794 Chromosome and associated proteins [BR:gma03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     AciX8_2794 DNA repair and recombination proteins [BR:gma03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Facilitator       AciX8_2794 SSDB OrthologParalogGFIT Motif Pfam:  HTH_8 HTH_30 HVO_A0261_N HTH_29 HTH_23 HTH_1 HTH_Crp_2 Motif Other DBs NCBI-ProteinID:  AEU37103 UniProt:  G8NNZ9 LinkDB All DBs Position 3434963..3435265 Genome browser AA seq 100 aa AA seqDB search MKRDLDNLVLQMHDAGIAYADAVREFKKRYILEVLARHRGNQCKAAEELGMHRNTLSRTL VELDMDSTQIKKGLRRPPRPVRPERSPLQIVSGGRISGGR NT seq 303 nt NT seq  +upstreamnt  +downstreamnt gtgaaacgcgatctcgacaacctcgtcctccagatgcacgatgcaggcatcgcctacgcc gatgctgtgcgggaatttaaaaagcgctacattctggaagtactcgcgcgccatcgaggc aaccagtgcaaggccgccgaagagctgggcatgcaccgcaacaccctcagccgcacgctc gtcgagctcgatatggactccacccagatcaagaaaggtttgcgccgcccacctcggcct gtgcgtcctgaacgctccccgctgcaaattgtctccggcggacgcatttccgggggacga tag

DBGET integrated database retrieval system