Geobacillus sp. Y4.1MC1: GY4MC1_2006 Help Entry GY4MC1_2006       CDS       T01348                                  Name (GenBank) glutaredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism gmc  Geobacillus sp. Y4.1MC1 Brite KEGG Orthology (KO) [BR:gmc00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     GY4MC1_2006 Enzymes [BR:gmc01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      GY4MC1_2006 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 DUF2292 Motif Other DBs NCBI-ProteinID:  ADP74750 UniProt:  A0A7U3YFQ3 LinkDB All DBs Position complement(1984052..1984297) Genome browser AA seq 81 aa AA seqDB search MLELYGAKGCPYTRELRESLLWDGKEFVEYDVDEDKEALKQLIVLTGGGTVPVLVEDGRV IQVGVSGRGCMVALPSTKGFK NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcttgagctgtatggcgcgaaaggatgtccttacacgagagaattgcgggaaagttta ctatgggacggaaaagaatttgtcgagtatgatgtcgatgaagacaaagaggcattaaag cagctgatcgttttgacgggagggggcaccgttcctgtcttagtagaagatgggcgggtc attcaagtaggagtttccggtcgtggttgcatggttgcattgccgtccacaaagggattt aaatag

DBGET integrated database retrieval system