Geobacter metallireducens: Gmet_1177 Help Entry Gmet_1177         CDS       T00295                                  Symbol zapB Name (GenBank) cell division protein ZapB   KO K09892   cell division protein ZapB Organism gme  Geobacter metallireducens Brite KEGG Orthology (KO) [BR:gme00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:gme03036]     Gmet_1177 (zapB) Chromosome and associated proteins [BR:gme03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     Gmet_1177 (zapB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB HALZ NRBF2 Cep57_CLD_2 bZIP_1 GAS XRCC4_CC YabA CCDC138_cc DUF6262 SKA2 DivIC JIP_LZII Med21 MS_N KAR9 Motif Other DBs NCBI-ProteinID:  ABB31415 UniProt:  Q39WF9 LinkDB All DBs Position 1304795..1304971 Genome browser AA seq 58 aa AA seqDB search MDTELFTDLERRVETLVERYTALKRENDVLREENGRLLQERDAVKSRIDGVLRKLEGI NT seq 177 nt NT seq  +upstreamnt  +downstreamnt atggacacagaactgttcaccgatctcgaacggcgcgttgagactctcgtagaacgatac accgcccttaagcgggagaatgacgtccttcgcgaggaaaacggtcggctcctgcaggag cgggatgccgtcaagtcaagaatagacggtgttctgaggaagctcgaagggatttga

DBGET integrated database retrieval system