Geobacter metallireducens: Gmet_1602 Help Entry Gmet_1602         CDS       T00295                                  Symbol acpP-2 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gme  Geobacter metallireducens Pathway gme01100   Metabolic pathways gme01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gme00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Gmet_1602 (acpP-2)    00074 Mycolic acid biosynthesis     Gmet_1602 (acpP-2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Gmet_1602 (acpP-2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF1493 Motif Other DBs NCBI-ProteinID:  ABB31834 UniProt:  Q39V90 LinkDB All DBs Position 1802879..1803112 Genome browser AA seq 77 aa AA seqDB search MSAIDKRVKEIVAEQLGVDEAQVTNEASFMDDLGADSLDTVELVMALEEEFDIEISDEDA EKIQSVQDAIDYITEHT NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgtcagcgatagacaaaagggttaaagagatcgttgccgaacagcttggcgtcgatgaa gcacaggtaacgaatgaggcatcgttcatggacgatctgggtgccgattctcttgatacc gtggaactggtgatggccctcgaggaggagttcgacatcgagatctccgacgaagacgca gagaagatccaaagcgtacaggacgccatcgactacatcaccgagcatacctaa

DBGET integrated database retrieval system