KEGG   Globicephala melas (long-finned pilot whale): 115842158
Entry
115842158         CDS       T11080                                 
Symbol
TIGIT
Name
(RefSeq) T-cell immunoreceptor with Ig and ITIM domains
  KO
K16350  T-cell immunoreceptor with Ig and ITIM domains
Organism
gmf  Globicephala melas (long-finned pilot whale)
Pathway
gmf04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:gmf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    115842158 (TIGIT)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:gmf04515]
    115842158 (TIGIT)
Cell adhesion molecules [BR:gmf04515]
 Immunoglobulin superfamily
  L1 family
   115842158 (TIGIT)
SSDB
Motif
Pfam: V-set ig Ig_3 Ig_2 I-set CAAX_1
Other DBs
NCBI-GeneID: 115842158
NCBI-ProteinID: XP_060153552
LinkDB
Position
4:60220101..60235420
AA seq 249 aa
MQWCLLLLWAQGLRQARLPASGAVTGRIVTTGNISAEEGGSVTLQCHLSSTTAKVTQVNW
KQQDHVLAIHHASLGWYIDPAFTERMVPGPNLGLTLQSLTRNDTGEYICIYHTYPDGIYK
GTVFLEVLQSSVAEHSAGFQIPLLGAMATVLAVIGTAVIVVLTLARKFFCFWKKSLRIRS
AEGGLGRRLSEQEEWRPGVPSSPGSCVRADAGLCREQPGEDRAEPEPHDYFNVLSYRSLA
SFSFPAEEG
NT seq 750 nt   +upstreamnt  +downstreamnt
atgcagtggtgtctcctactgctctgggcccaggggctgaggcaggctcgcctccctgcc
tcaggagctgtgacaggcagaatagtaacaacggggaacatttctgcagaggaaggtggc
tctgtcaccttacaatgtcacctctcctccactactgccaaagtgacccaggtcaactgg
aaacagcaggaccacgtcctggccattcatcatgccagcctggggtggtacatcgaccca
gccttcacggagcgaatggtcccaggccccaacctgggcctcaccctccagtccctgacc
aggaacgacacaggagagtacatctgcatctatcacacctaccctgatggcatttacaaa
gggacagtctttctggaagtcctacaaagctcagtggctgagcacagcgctgggttccag
atcccactgcttggagccatggccacagtgctggcagtcatcggcacagcagtcattgtg
gtgctcacactggccagaaagtttttttgtttttggaagaaatctctcagaatccgttct
gcggaaggtggcctcgggaggaggctgtctgaacaggaggagtggaggcccggcgtcccg
tcctccccgggcagctgtgtgcgtgcggacgccggcctctgcagggagcagccgggagag
gaccgcgcagagcccgagccgcacgactacttcaacgtcttgagttacagaagcctcgcg
agcttcagcttccccgccgaggagggctag

DBGET integrated database retrieval system