Globicephala melas (long-finned pilot whale): 115843408
Help
Entry
115843408 CDS
T11080
Symbol
CCDC172
Name
(RefSeq) coiled-coil domain-containing protein 172
KO
K25624
coiled-coil domain-containing protein 172
Organism
gmf Globicephala melas (long-finned pilot whale)
Brite
KEGG Orthology (KO) [BR:
gmf00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
03037 Cilium and associated proteins [BR:
gmf03037
]
115843408 (CCDC172)
Cilium and associated proteins [BR:
gmf03037
]
Motile cilia and associated proteins
Sperm associated proteins
115843408 (CCDC172)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
GAS
TPR_MLP1_2
Bcr-Abl_Oligo
Motif
Other DBs
NCBI-GeneID:
115843408
NCBI-ProteinID:
XP_030695224
LinkDB
All DBs
Position
16:complement(13970769..14013304)
Genome browser
AA seq
260 aa
AA seq
DB search
MSLESLFQHIILSEHLSEENRRLMRQVRSEINRCRENIKKAAEELNEEKIKLESKIQQFS
EKAFLLQLLKTHENALERQCSEITSQRNMLLQTFEATKRKVTEEEEKFIKEITDFNNEYE
ITKKRELLMKENVKIQISDLENEANILKMEMKSAEHDSGQLNELQKQKSELIQELFTLQR
ELKGFEDKKKEAVCTTKYLEAEKIKISEKPQNDAECLRLKKELELYKEDDMQSVYDALQT
EIEFLQLTLAQKDLQETKNL
NT seq
783 nt
NT seq
+upstream
nt +downstream
nt
atgagtctggagtccctgtttcagcacatcatcctctccgagcacctgtcggaggagaat
cgccgcttgatgcgacaagtcaggtcggaaataaacagatgtcgtgaaaacattaagaaa
gcagcagaggagctgaatgaggagaaaatcaagttggaatcgaagattcagcagttttct
gaaaaagccttcctcttacagcttttgaaaactcatgaaaatgccttagaaagacagtgc
agtgaaattacaagccaaaggaatatgcttctccaaacgtttgaagctacaaagagaaaa
gtgacagaggaggaagaaaaatttattaaggaaattacagacttcaataatgagtatgaa
ataacaaagaaacgagagcttttgatgaaagaaaatgtcaagattcaaatatctgactta
gaaaacgaggcaaacattctgaaaatggaaatgaagtcagcggaacatgatagtggccag
ttaaatgaacttcaaaaacaaaagagtgaattgatacaagaattatttactttgcagaga
gagcttaaaggttttgaagataaaaaaaaggaagccgtttgtactaccaagtacctagag
gcagaaaaaataaaaatcagtgaaaagcctcaaaatgatgctgaatgcttaagacttaaa
aaagaattagaactttataaggaagatgacatgcaaagtgtttatgatgctctccagaca
gaaatagaatttttgcagttgacattggcacagaaagatcttcaggaaactaaaaacttg
tag
DBGET
integrated database retrieval system