Globicephala melas (long-finned pilot whale): 115854512
Help
Entry
115854512 CDS
T11080
Symbol
NDUFA8
Name
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
KO
K03952
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 8
Organism
gmf Globicephala melas (long-finned pilot whale)
Pathway
gmf00190
Oxidative phosphorylation
gmf01100
Metabolic pathways
gmf04714
Thermogenesis
gmf04723
Retrograde endocannabinoid signaling
gmf04932
Non-alcoholic fatty liver disease
gmf05010
Alzheimer disease
gmf05012
Parkinson disease
gmf05014
Amyotrophic lateral sclerosis
gmf05016
Huntington disease
gmf05020
Prion disease
gmf05022
Pathways of neurodegeneration - multiple diseases
gmf05208
Chemical carcinogenesis - reactive oxygen species
gmf05415
Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:
gmf00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
115854512 (NDUFA8)
09150 Organismal Systems
09156 Nervous system
04723 Retrograde endocannabinoid signaling
115854512 (NDUFA8)
09159 Environmental adaptation
04714 Thermogenesis
115854512 (NDUFA8)
09160 Human Diseases
09161 Cancer: overview
05208 Chemical carcinogenesis - reactive oxygen species
115854512 (NDUFA8)
09164 Neurodegenerative disease
05010 Alzheimer disease
115854512 (NDUFA8)
05012 Parkinson disease
115854512 (NDUFA8)
05014 Amyotrophic lateral sclerosis
115854512 (NDUFA8)
05016 Huntington disease
115854512 (NDUFA8)
05020 Prion disease
115854512 (NDUFA8)
05022 Pathways of neurodegeneration - multiple diseases
115854512 (NDUFA8)
09166 Cardiovascular disease
05415 Diabetic cardiomyopathy
115854512 (NDUFA8)
09167 Endocrine and metabolic disease
04932 Non-alcoholic fatty liver disease
115854512 (NDUFA8)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CHCH
Cmc1
CX9C
Motif
Other DBs
NCBI-GeneID:
115854512
NCBI-ProteinID:
XP_030714624
LinkDB
All DBs
Position
6:12964467..12979030
Genome browser
AA seq
206 aa
AA seq
DB search
MRRRYVAHGSRKGSSRRRGRRGSGHLLGVGATAVMPGIVELPTLEDLKVQEVKVSSSVLK
AAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEESKLVNQCALDFFRQIKQHCSEPFTEYW
TCIDYSGLQLFRRCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYDSRA
RPEPSPETEGDLKPARHGSRLFFWTM
NT seq
621 nt
NT seq
+upstream
nt +downstream
nt
atgcgcagacggtacgtggcccacggcagtcggaaggggagttcaaggagacgtgggcga
cgcggcagcgggcacctcctcggggtcggggctaccgccgtcatgcccgggatagtggag
ctgcccactctggaggacctgaaagtgcaggaggtgaaagtcagttcttctgtgctgaaa
gctgcggcccatcactacggagctcagtgcgataagcccaacaaggagttcatgctctgc
cggtgggaagagaaggacccgaggcggtgtttagaggaaagcaagcttgtcaaccagtgt
gccctggacttctttaggcagataaagcagcactgttcggagccttttacagaatactgg
acctgcatcgattactccggcttgcagttatttcgtcggtgtcgcaaacagcaggcgaag
tttgacgagtgtgtgttggacaaactgggctgggtgcgacccgacctgggggagctgtca
aaggtcaccaaagtgaaaacagatcggcctttaccagagaatccctatgactcaagagcg
aggccagagcccagccctgagacggaaggagatctgaagcccgccagacatggcagccgc
ctctttttctggaccatgtga
DBGET
integrated database retrieval system