Gadus morhua (Atlantic cod): 115531089 Help Entry 115531089         CDS       T10832                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism gmh  Gadus morhua (Atlantic cod) Pathway gmh04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:gmh00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     115531089  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:gmh04121]     115531089    03400 DNA repair and recombination proteins [BR:gmh03400]     115531089 Ubiquitin system [BR:gmh04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      115531089    Cul5 complex      115531089 DNA repair and recombination proteins [BR:gmh03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      115531089 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Motif Other DBs NCBI-GeneID:  115531089 NCBI-ProteinID:  XP_030195979 Ensembl:  ENSGMOG00000005628 UniProt:  A0A8C4Z4H5 LinkDB All DBs Position 18:complement(8773425..8777245) Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRQKTTIFTDAKESTTVYELKRIVEGILKRAPEDQRLYKDEQLLEDSKSLGDC GFTSQTARPQAPGTVGLAFRITDEMFEALQMESFSSPPELPDVMKPQDSSSTASEQTVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtctttctaatgatccggcgtcagaagacgaccatcttcacggacgccaaggag tcgaccaccgtgtacgagttgaaacgtatcgtggagggcattctgaagagggccccagag gaccagcgcctctacaaagacgagcagctgttggaggacagcaagtctctgggagactgt ggcttcaccagtcagacggcccgaccccaagcccccggtaccgttggcctggccttccgc atcactgacgagatgttcgaggcgctccagatggagagcttctccagccctccagagcta cccgacgtcatgaagccacaggactccagcagcacggccagcgagcagaccgtccagtga

DBGET integrated database retrieval system