Gadus morhua (Atlantic cod): 115532401 Help Entry 115532401         CDS       T10832                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism gmh  Gadus morhua (Atlantic cod) Pathway gmh03082   ATP-dependent chromatin remodeling gmh04217   Necroptosis Brite KEGG Orthology (KO) [BR:gmh00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     115532401  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     115532401  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:gmh03036]     115532401   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gmh04147]     115532401 Chromosome and associated proteins [BR:gmh03036]  Eukaryotic type   Nucleosome assembly factors    Histones     115532401 Exosome [BR:gmh04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    115532401 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  115532401 NCBI-ProteinID:  XP_030198040 LinkDB All DBs Position 2:complement(4463827..4465387) Genome browser AA seq 127 aa AA seqDB search MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAHRVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TEKPAKK NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgtctggaagaggtaaaaccggaggcaaagccagggcgaaggccaagacccgctcatcc cgtgcaggactccagttcccagtcggccgtgtgcacagactccttcgtaagggaaactat gctcaccgcgtcggtgccggagctcccgtctacctggcggcggttctcgagtatctgacc gctgagatcctggagttggctggaaacgctgcccgcgacaacaagaagacccgcatcatc ccccgccatctgcagctggccgtccgcaacgacgaggagctcaacaaactcctaggcgga gtgaccatcgctcaaggcggtgtgctgcccaacatccaggccgttcttctgcccaagaag accgagaagcccgccaagaaatag

DBGET integrated database retrieval system