Gadus morhua (Atlantic cod): 115535333 Help Entry 115535333         CDS       T10832                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism gmh  Gadus morhua (Atlantic cod) Pathway gmh04382   Cornified envelope formation gmh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:gmh00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     115535333  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     115535333  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gmh04147]     115535333 Exosome [BR:gmh04147]  Exosomal proteins   Exosomal proteins of microglial cells    115535333 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EH NNH2 DREV Motif Other DBs NCBI-GeneID:  115535333 NCBI-ProteinID:  XP_030202239 Ensembl:  ENSGMOG00000030248 LinkDB All DBs Position 22:11826543..11828209 Genome browser AA seq 101 aa AA seqDB search MPSELEKAMESLIMVFHRYASKDSKNGTLSRRELRDLMENELSGFLKSQKDPAAVDKIMK DLDTNGDGQVDFEEFVSLVVGLSIACEQCYKMQLSTGGKKH NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgccttcagaactggagaaagcaatggagtccctcatcatggtgttccatcgctacgcg tccaaggatagcaagaacggcacgcttagccggcgggagctgagagatctgatggagaac gagttgtctggcttcctcaagtctcagaaggaccccgccgcggtggacaagatcatgaag gatctggacaccaacggcgatggccaggtggactttgaggagtttgtgtctctagtggtc ggactctcaatcgcctgcgagcagtgttataagatgcaattgagcacgggaggcaagaag cattaa

DBGET integrated database retrieval system