Gadus morhua (Atlantic cod): 115537239 Help Entry 115537239         CDS       T10832                                  Name (RefSeq) elongin-B isoform X1   KO K03873   elongin-B Organism gmh  Gadus morhua (Atlantic cod) Pathway gmh04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:gmh00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     115537239  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:gmh04121]     115537239    03400 DNA repair and recombination proteins [BR:gmh03400]     115537239 Ubiquitin system [BR:gmh04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      115537239    Cul5 complex      115537239 DNA repair and recombination proteins [BR:gmh03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      115537239 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  115537239 NCBI-ProteinID:  XP_030204860 Ensembl:  ENSGMOG00000013626 LinkDB All DBs Position 2:complement(2048786..2054026) Genome browser AA seq 123 aa AA seqDB search MVGLQDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRSPEEQRLYKDDLLLDDSKT LGDCGFTNQTARPQGPATVGLAFRLGDDSFEQLRIEAFSSPPELPDVMKPQDSGSTANEQ AVQ NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atggtggggctccaggatgtttttctaatgatccgacgtcataagacgaccatcttcact gatgcgaaggagtccacgacagtatacgagctgaagcgcatcgtggaaggtattcttaag aggtcgccagaggaacagaggctttataaggatgacctgttgctggacgacagtaaaacg ctgggagactgtggcttcacaaaccagaccgcccggccccagggtccagccactgtggga ttagcatttcgtcttggagatgactcgttcgagcagctgcggatcgaggcgttctccagc cctccggagctccccgacgtcatgaagccccaggactccggcagcacggccaatgagcag gcggtgcagtga

DBGET integrated database retrieval system