Gadus morhua (Atlantic cod): 115540717 Help Entry 115540717         CDS       T10832                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism gmh  Gadus morhua (Atlantic cod) Pathway gmh04060   Cytokine-cytokine receptor interaction gmh04218   Cellular senescence gmh04620   Toll-like receptor signaling pathway gmh04621   NOD-like receptor signaling pathway gmh04622   RIG-I-like receptor signaling pathway gmh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:gmh00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     115540717  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     115540717  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     115540717    04621 NOD-like receptor signaling pathway     115540717    04622 RIG-I-like receptor signaling pathway     115540717  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     115540717  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:gmh04052]     115540717    00536 Glycosaminoglycan binding proteins [BR:gmh00536]     115540717 Cytokines and neuropeptides [BR:gmh04052]  Cytokines   Chemokines    115540717 Glycosaminoglycan binding proteins [BR:gmh00536]  Heparan sulfate / Heparin   Chemokines    115540717 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 DUF7238 Motif Other DBs NCBI-GeneID:  115540717 NCBI-ProteinID:  XP_030208102 Ensembl:  ENSGMOG00000034682 UniProt:  A0A8C5FJD9 LinkDB All DBs Position 3:5654673..5658213 Genome browser AA seq 101 aa AA seqDB search MRNSSSKIPISPLLVLLALLTITEGISLRGLGMELRCRCIQKERRLIRHYIEKVEIIPAN SHCEKSEIIATLKKTGQEVCLDNEAPWVKKVIKRMMSSKRL NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgaggaattcaagcagcaaaatccccatcagcccactactggttctcctagccttgttg accattactgaaggaataagtctgagggggttggggatggaactgcgctgccgctgcatc cagaaagagagacgtttgattcgtcattacatcgagaaagttgagatcattccggccaat tctcactgtgaaaaatctgagatcattgccactctgaaaaagacgggtcaagaggtctgt ctggataatgaagctccatgggtcaagaaagttattaagaggatgatgtcaagcaaaagg ctttga

DBGET integrated database retrieval system