Gadus morhua (Atlantic cod): 115546026 Help Entry 115546026         CDS       T10832                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism gmh  Gadus morhua (Atlantic cod) Pathway gmh03082   ATP-dependent chromatin remodeling gmh04217   Necroptosis Brite KEGG Orthology (KO) [BR:gmh00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     115546026  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     115546026  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:gmh03036]     115546026   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gmh04147]     115546026 Chromosome and associated proteins [BR:gmh03036]  Eukaryotic type   Nucleosome assembly factors    Histones     115546026 Exosome [BR:gmh04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    115546026 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  115546026 NCBI-ProteinID:  XP_030215473 Ensembl:  ENSGMOG00000034351 UniProt:  A0A8C5A052 A0ABA3L8R2 A0ABA3M082 LinkDB All DBs Position 6:18731651..18733582 Genome browser AA seq 127 aa AA seqDB search MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAHRVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TEKPAKK NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgtcaggaaggggcaagaccggtggaaaagctagggcaaaggccaagacccgctcatcc cgtgccgggctccagtttcctgtcggcagagtgcaccgacttctacgtaaaggcaactac gctcatcgcgtcggcgctggagctcccgtctacctggccgcggtgctcgagtatttgacc gctgagatcctggagttggctggaaacgctgcccgcgacaacaagaagacccgaatcatc ccccgccatctacagctggccgtccgcaacgacgaggagctcaacaaactcctgggcgga gtgaccatcgctcagggtggtgtgctgcccaacatccaggcagttcttctgcccaagaag actgaaaagcccgccaaaaagtaa

DBGET integrated database retrieval system