Gadus morhua (Atlantic cod): 115553250 Help Entry 115553250         CDS       T10832                                  Name (RefSeq) calmodulin-alpha-like   KO K02183   calmodulin Organism gmh  Gadus morhua (Atlantic cod) Pathway gmh04020   Calcium signaling pathway gmh04070   Phosphatidylinositol signaling system gmh04114   Oocyte meiosis gmh04218   Cellular senescence gmh04261   Adrenergic signaling in cardiomyocytes gmh04270   Vascular smooth muscle contraction gmh04371   Apelin signaling pathway gmh04625   C-type lectin receptor signaling pathway gmh04744   Phototransduction gmh04910   Insulin signaling pathway gmh04912   GnRH signaling pathway gmh04916   Melanogenesis Brite KEGG Orthology (KO) [BR:gmh00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     115553250    04020 Calcium signaling pathway     115553250    04070 Phosphatidylinositol signaling system     115553250  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     115553250    04218 Cellular senescence     115553250  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     115553250   09152 Endocrine system    04910 Insulin signaling pathway     115553250    04912 GnRH signaling pathway     115553250    04916 Melanogenesis     115553250   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     115553250    04270 Vascular smooth muscle contraction     115553250   09157 Sensory system    04744 Phototransduction     115553250  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:gmh01009]     115553250   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gmh04131]     115553250    03036 Chromosome and associated proteins [BR:gmh03036]     115553250   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gmh04147]     115553250 Protein phosphatases and associated proteins [BR:gmh01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      115553250 Membrane trafficking [BR:gmh04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     115553250 Chromosome and associated proteins [BR:gmh03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      115553250 Exosome [BR:gmh04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    115553250 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 AIF-1 EF-hand_9 Poly_export Motif Other DBs NCBI-GeneID:  115553250 NCBI-ProteinID:  XP_030225214 LinkDB All DBs Position 11:complement(1888001..1888462) Genome browser AA seq 143 aa AA seqDB search MGPRAKPAKEGDARHQQEEEPAGRALPAQTDMADQLTEEQIAEFKEAFSLFDKDGDGTIT TKELGTVRHSLGQNPTEAELQDMINEVDGNGTIDFPEFLTMRARKLKETDGEEEIREAFR GFDKNGGGGDSGKRRAVNGSGSG NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atgggaccaagagccaagccggccaaagagggcgatgcacgtcaccagcaggaagaggaa ccggctggaagagcactacctgcgcaaacagacatggctgaccaactaacagaagagcag attgctgagttcaaggaggccttctccctcttcgataaggacggcgatggcaccatcacc accaaggagctgggcaccgtgaggcactctctgggccagaaccccacggaggccgagctg caggacatgatcaacgaggtggacggcaacggcactatcgacttcccagagttcctgacc atgagggcgaggaagctgaaggaaacagacggcgaggaggagatcagggaggccttccga gggttcgacaagaacggtggcggcggcgatagcggtaaacggcgagcggtgaacggcagc ggtagcgggtag

DBGET integrated database retrieval system