Gadus morhua (Atlantic cod): 115554072 Help Entry 115554072         CDS       T10832                                  Name (RefSeq) protein S100-A1-like isoform X1   KO K17274   protein S100-A10 Organism gmh  Gadus morhua (Atlantic cod) Pathway gmh04382   Cornified envelope formation gmh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:gmh00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     115554072  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     115554072  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gmh04147]     115554072 Exosome [BR:gmh04147]  Exosomal proteins   Exosomal proteins of microglial cells    115554072 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_6 DEK_C EF-hand_8 Sec5 EF-hand_FSTL1 Motif Other DBs NCBI-GeneID:  115554072 NCBI-ProteinID:  XP_030226543 Ensembl:  ENSGMOG00000029217 LinkDB All DBs Position 11:complement(3808058..3809309) Genome browser AA seq 99 aa AA seqDB search MSELEKCMESLISVFHRYAAGDGDKATLTKKELKQLLEKEFSTFLSAQKSPDAVDKIMKD LDQNNDKKVDFGEFMVFVVGLSTACEAFHRAQQKKGKKL NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgtctgagcttgagaagtgcatggagtctctgatctctgtcttccaccgctatgctgcc ggcgatggagacaaggcaaccctaacaaaaaaggagcttaagcagctgttggagaaagag ttttccacgttcctctctgcccagaaaagccctgacgcagtcgataaaataatgaaggac ctggatcagaacaacgataagaaggtggattttggagagtttatggtttttgtcgtcggc ctctccaccgcatgtgaagcatttcatcgggcacagcaaaaaaaagggaaaaaactgtga

DBGET integrated database retrieval system