Gadus morhua (Atlantic cod): 115558667 Help Entry 115558667         CDS       T10832                                  Symbol pole3 Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism gmh  Gadus morhua (Atlantic cod) Pathway gmh03030   DNA replication gmh03082   ATP-dependent chromatin remodeling gmh03410   Base excision repair gmh03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:gmh00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     115558667 (pole3)    03410 Base excision repair     115558667 (pole3)    03420 Nucleotide excision repair     115558667 (pole3)   09126 Chromosome    03082 ATP-dependent chromatin remodeling     115558667 (pole3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:gmh03032]     115558667 (pole3)    03036 Chromosome and associated proteins [BR:gmh03036]     115558667 (pole3)    03400 DNA repair and recombination proteins [BR:gmh03400]     115558667 (pole3) Enzymes [BR:gmh01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      115558667 (pole3) DNA replication proteins [BR:gmh03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     115558667 (pole3) Chromosome and associated proteins [BR:gmh03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     115558667 (pole3) DNA repair and recombination proteins [BR:gmh03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       115558667 (pole3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C N6_N4_Mtase SpoU_methylase COG2_C TAF Afi1 DUF4746 CDC45 NOA36 Motif Other DBs NCBI-GeneID:  115558667 NCBI-ProteinID:  XP_030232843 Ensembl:  ENSGMOG00000025333 UniProt:  A0A8C5BP64 LinkDB All DBs Position 14:complement(10521747..10523617) Genome browser AA seq 144 aa AA seqDB search MAERPEDLNLPNAVITRIIKEALPDGVNVSKEARRAISQAASVFVLYATSCANNFAMKAK RKTLNAADVLAAMEEMEFERFLEPLREALEVYKKGKKEVSDQKRKEKEKKETDNDKSREE EDDEERMEEEPEAENDAEEEEVEN NT seq 435 nt NT seq  +upstreamnt  +downstreamnt atggcggaaagacccgaggaccttaaccttccgaacgctgttattactcgcattattaaa gaggcgctaccggatggtgttaatgtgtccaaagaagcaagaagggcaatatcgcaagcg gccagtgtattcgttttgtatgcaacttcatgcgcaaacaattttgctatgaaagcaaaa agaaaaactctgaatgcagcagatgtgttggctgccatggaggaaatggagtttgaacgg tttttggagcctctaagggaagcattggaagtttacaaaaaagggaaaaaggaggtgtct gatcagaaacgcaaagaaaaagagaagaaggagacagataatgataagagtcgagaggaa gaggatgatgaagagcgaatggaggaagagccagaggctgaaaatgatgcagaggaggag gaagtggagaactaa

DBGET integrated database retrieval system