KEGG   Glutamicibacter mishrai: NMP99_09180
Entry
NMP99_09180       CDS       T08378                                 
Name
(GenBank) YggS family pyridoxal phosphate-dependent enzyme
  KO
K06997  PLP dependent protein
Organism
gmi  Glutamicibacter mishrai
Brite
KEGG Orthology (KO) [BR:gmi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99985 Amino acid metabolism
    NMP99_09180
SSDB
Motif
Pfam: Ala_racemase_N T2SSM_b CBP
Other DBs
NCBI-ProteinID: UTT38244
LinkDB
Position
complement(1939839..1940573)
AA seq 244 aa
MTSQPAAAHAATTEDFIRNLAAVNQRIAAACAAAGREAGSVRLLPVTKTIGTERLGLAIA
AGVDTLGENKVQEAHGKYEHFREDFPHLRYAIIGPLQTNKAKFVAQFADEFHALDSLKLA
ETLQRRLELEDRTLEVFIQVNTSGEESKSGILASEAAGLLASLAPLDRLTPVGLMTMAAN
TNDEQQVRGNFASLRQTLEQLQQNAPQGFEHLSMGMSGDYELAIAEGATVVRVGQGIFGA
RNYA
NT seq 735 nt   +upstreamnt  +downstreamnt
ttgacttcgcaacctgctgccgcccatgcggccactaccgaggatttcattcgcaatctg
gcagcggtcaatcagcgcatcgccgccgcgtgcgctgcagcgggccgtgaggccggctcg
gtgcgcttgctgccggtgaccaagaccatcggcaccgagcggctgggactggccattgcc
gccggggtggacaccttgggggagaacaaggtgcaagaggcccatggcaagtatgagcac
ttccgcgaggacttcccccacctgcgctacgccatcatcggcccgctgcaaaccaacaag
gcgaagttcgtcgctcaattcgccgatgagttccacgccttggactcattgaagctggca
gagacgttgcagcgccggctcgagctggaggatcggacgctggaagtcttcatccaggtc
aatacttcgggggaggaaagcaagtccgggatcctggcatccgaggccgccggcttgctg
gcctccttggctccgctggatcgactcaccccggtgggcctgatgaccatggcggccaac
acgaatgacgagcaacaggttcgcggcaatttcgcctctttgcgccagacgctggagcag
ctgcagcagaacgctccgcagggcttcgaacacctgtcgatgggcatgagcggcgactac
gagctcgccatcgccgagggggcgactgtggtgcgtgtgggtcaagggatcttcggcgcc
cgcaactatgcctga

DBGET integrated database retrieval system