Glutamicibacter mishrai: NMP99_13245 Help Entry NMP99_13245       CDS       T08378                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism gmi  Glutamicibacter mishrai Brite KEGG Orthology (KO) [BR:gmi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:gmi03032]     NMP99_13245    03036 Chromosome and associated proteins [BR:gmi03036]     NMP99_13245    03400 DNA repair and recombination proteins [BR:gmi03400]     NMP99_13245 DNA replication proteins [BR:gmi03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     NMP99_13245 Chromosome and associated proteins [BR:gmi03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     NMP99_13245 DNA repair and recombination proteins [BR:gmi03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       NMP99_13245 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG tRNA_anti-like DUF2267 Motif Other DBs NCBI-ProteinID:  UTT38967 LinkDB All DBs Position complement(2779639..2779923) Genome browser AA seq 94 aa AA seqDB search MAMNRSELVAAVAAKTENSQVAVNGVLDAVFEVFVDQISKGEKVTIPGWLAVERTDRAAR TGRNPQTGEAIQIPAGHSVKLTAGSKLKAAVAKK NT seq 285 nt NT seq  +upstreamnt  +downstreamnt ttggctatgaaccgtagcgaacttgttgcagccgttgcagcgaagaccgaaaactcccag gttgccgtcaacggtgttctggatgccgtattcgaagtattcgtcgaccagatttccaag ggcgaaaaggtcaccatcccaggctggttggctgtagagcgcaccgatcgtgcagctcgc accggccgcaacccacagaccggcgaagcaatccagattcctgctggccactcggtcaag ctgaccgctggttcgaagctgaaggcagctgttgccaagaagtaa

DBGET integrated database retrieval system