Gloeobacter morelensis: ISF26_10575 Help Entry ISF26_10575       CDS       T07869                                  Name (GenBank) cytochrome b559 subunit beta   KO K02708   photosystem II cytochrome b559 subunit beta Organism gml  Gloeobacter morelensis Pathway gml00195   Photosynthesis gml01100   Metabolic pathways Module gml_M00161   Photosystem II gml_M00611   Oxygenic photosynthesis in plants and cyanobacteria Brite KEGG Orthology (KO) [BR:gml00001]  09100 Metabolism   09102 Energy metabolism    00195 Photosynthesis     ISF26_10575  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:gml00194]     ISF26_10575 Photosynthesis proteins [BR:gml00194]  Photosystem and electron transport system   Photosystem II (P680 chlorophyll a) [OT]    Main subunits     ISF26_10575 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_B559 MFS_2 Motif Other DBs NCBI-ProteinID:  UFP96616 UniProt:  A0ABY3PSD0 LinkDB All DBs Position complement(2183760..2183915) Genome browser AA seq 51 aa AA seqDB search MTTSSNRPTPGGPTQPVSYPVFTVRWLAVHALAVPTIFFLGALAAMQFIQR NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atgaccacttcttcaaaccgtcctacccccggtggcccgacccagcccgtctcctacccg gtcttcaccgtccgctggctggcggtccacgccctggccgtgcccacgatcttcttcctg ggtgccctggccgcgatgcagtttattcagcgctaa

DBGET integrated database retrieval system