Gloeobacter morelensis: ISF26_13940 Help Entry ISF26_13940       CDS       T07869                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism gml  Gloeobacter morelensis Brite KEGG Orthology (KO) [BR:gml00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:gml03032]     ISF26_13940    03036 Chromosome and associated proteins [BR:gml03036]     ISF26_13940    03400 DNA repair and recombination proteins [BR:gml03400]     ISF26_13940 DNA replication proteins [BR:gml03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     ISF26_13940 Chromosome and associated proteins [BR:gml03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     ISF26_13940 DNA repair and recombination proteins [BR:gml03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       ISF26_13940 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  UFP92921 LinkDB All DBs Position 2915812..2916102 Genome browser AA seq 96 aa AA seqDB search MNKGELVDAVAKKAKLAKKDVDAIVGAAFDVIVEAVSRGDKVTLVGFGSFEPRKRAAREG RNPKTREKMTIAATTVPAFSAGKQFREAVSSSAQAD NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaggtgaattagtggacgccgtcgccaagaaagccaagctggccaaaaaggac gtcgatgcgatcgtgggtgcggccttcgatgtgattgtcgaagcggtctcgcggggcgac aaagtcaccctggtgggtttcggttcgtttgaaccgcgcaagcgcgccgcccgcgaaggc cgcaatcccaagacccgcgagaagatgaccatcgccgcgacgaccgtgccggctttttcg gcgggcaagcagtttcgagaagccgtctccagttctgcccaagcggactaa

DBGET integrated database retrieval system