Gulosibacter molinativorax: GMOLON4_1029 Help Entry GMOLON4_1029      CDS       T08641                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism gmn  Gulosibacter molinativorax Pathway gmn01100   Metabolic pathways gmn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gmn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GMOLON4_1029 (acpP)    00074 Mycolic acid biosynthesis     GMOLON4_1029 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GMOLON4_1029 (acpP) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QUY61739 LinkDB All DBs Position 1062330..1062581 Genome browser AA seq 83 aa AA seqDB search MALSKDEILAGLAELVNEETGIASDTVTGDKSFTDDLDIDSISMMTIVVNAEEKFDVQIP DAEVENLKTVQDAVDYIANAQDA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggcactttcaaaggacgagattctcgcaggcctcgccgagctcgtaaacgaggagacc ggtatcgccagcgacacggtgaccggcgacaagtccttcacggacgacctcgacattgac tcgatctcgatgatgaccatcgtcgtgaacgcagaagagaagttcgacgtgcagattccg gacgccgaggtcgaaaacctcaagaccgttcaggacgcggtggactacatcgcgaacgcg caggacgcctag

DBGET integrated database retrieval system