Gemella morbillorum: NCTC11323_01741
Help
Entry
NCTC11323_01741 CDS
T05494
Symbol
cheY
Name
(GenBank) Chemotaxis protein CheY
KO
K03413
two-component system, chemotaxis family, chemotaxis protein CheY
Organism
gmo
Gemella morbillorum
Pathway
gmo02020
Two-component system
Brite
KEGG Orthology (KO) [BR:
gmo00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
NCTC11323_01741 (cheY)
09140 Cellular Processes
09142 Cell motility
02030 Bacterial chemotaxis
NCTC11323_01741 (cheY)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
gmo02022
]
NCTC11323_01741 (cheY)
02035 Bacterial motility proteins [BR:
gmo02035
]
NCTC11323_01741 (cheY)
Two-component system [BR:
gmo02022
]
CheA family
CheA-CheYBV (chemotaxis)
NCTC11323_01741 (cheY)
Bacterial motility proteins [BR:
gmo02035
]
Flagellar system
Chemotaxis proteins
Two component system proteins
NCTC11323_01741 (cheY)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Response_reg
Motif
Other DBs
NCBI-ProteinID:
SQH56242
LinkDB
All DBs
Position
1:complement(1757745..1758113)
Genome browser
AA seq
122 aa
AA seq
DB search
MKKSILIVDDSSYYRSRGAEIVERAGYNYYFAEDGKKALQMYSKIRPDYVTMDICMPIMD
GLEATKAICTKFPKAKILICSSVGHVPVYRRQAFANGACGILPKSYDLDDLEQAIEEADM
IK
NT seq
369 nt
NT seq
+upstream
nt +downstream
nt
atgaaaaaatctatacttattgtggacgatagttcttattatagaagtcgtggagcagaa
atagtagaacgtgcagggtataactattattttgcggaagatggaaaaaaagctcttcaa
atgtatagcaaaattagaccggactatgtaacaatggatatttgtatgcctattatggat
ggtctagaggcgacaaaagctatttgtacgaagtttccaaaggctaaaatattaatttgc
agtagtgtaggtcatgttcctgtctatcgtcgacaagcttttgctaatggtgcttgtgga
atacttccaaagagttatgatttagatgacttagagcaagctattgaagaagctgatatg
ataaaataa
DBGET
integrated database retrieval system