Gimesia maris: GmarT_38610 Help Entry GmarT_38610       CDS       T06180                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gmr  Gimesia maris Pathway gmr00998   Biosynthesis of various antibiotics gmr01100   Metabolic pathways gmr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gmr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GmarT_38610    00074 Mycolic acid biosynthesis     GmarT_38610   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GmarT_38610 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QEG17976 UniProt:  A0A3D3QYJ2 LinkDB All DBs Position complement(5060723..5060986) Genome browser AA seq 87 aa AA seqDB search MAPEQIRSVILDILSRIAPDEDLSDLDDSVPFREQMELDSMDFLDIVMELRKLYRVQIPE EDYGELVTMDSTVTYLTPLLKDAESTV NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggcgccggaacaaatcagatcggtaatcttggatatcttgtctcgtattgctcccgat gaagatctttcggatctggacgacagtgttcctttccgggagcagatggaactggacagc atggattttctggatattgtcatggagttacgcaaactctatcgtgtacagattcccgaa gaagactacggtgaactggtaactatggacagcactgtaacctacctgacaccactcctg aaggatgcggaaagcaccgtctga

DBGET integrated database retrieval system