Gaopeijia maritima: V3331_08610 Help Entry V3331_08610       CDS       T10606                                  Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism gmt  Gaopeijia maritima Pathway gmt00190   Oxidative phosphorylation gmt01100   Metabolic pathways Module gmt_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:gmt00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     V3331_08610  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:gmt00194]     V3331_08610 Photosynthesis proteins [BR:gmt00194]  Photosystem and electron transport system   F-type ATPase [OT]    V3331_08610 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  WZE83061 LinkDB All DBs Position complement(1961402..1961665) Genome browser AA seq 87 aa AA seqDB search MLHAFLAAVQDTAATGDAGLGLIGAGLAIGLTVIGAGLGIGRIGEGAVQGIARQPEAGAN IQTAGIILAALIEGAALFGLVLVFLLF NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgctgcacgcttttctcgctgccgttcaggacaccgctgccaccggcgacgccggtctg ggtctcatcggtgccggtctcgccatcggcctcaccgtgatcggtgccggtctgggcatc ggccgcatcggtgagggcgccgtccaggggatcgcccggcagcccgaggcgggtgccaac atccagaccgccgggatcatcctggccgccctcatcgagggtgcggcgctgttcggcctg gttctggtcttcctgctgttctga

DBGET integrated database retrieval system