KEGG   Girardinichthys multiradiatus (darkedged splitfin): 124876349
Entry
124876349         CDS       T08099                                 
Symbol
skp1
Name
(RefSeq) S-phase kinase-associated protein 1
  KO
K03094  S-phase kinase-associated protein 1
Organism
gmu  Girardinichthys multiradiatus (darkedged splitfin)
Pathway
gmu03083  Polycomb repressive complex
gmu04110  Cell cycle
gmu04114  Oocyte meiosis
gmu04120  Ubiquitin mediated proteolysis
gmu04141  Protein processing in endoplasmic reticulum
gmu04310  Wnt signaling pathway
gmu04350  TGF-beta signaling pathway
gmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    124876349 (skp1)
   04120 Ubiquitin mediated proteolysis
    124876349 (skp1)
  09126 Chromosome
   03083 Polycomb repressive complex
    124876349 (skp1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    124876349 (skp1)
   04350 TGF-beta signaling pathway
    124876349 (skp1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    124876349 (skp1)
   04114 Oocyte meiosis
    124876349 (skp1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    124876349 (skp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gmu04131]
    124876349 (skp1)
   04121 Ubiquitin system [BR:gmu04121]
    124876349 (skp1)
   03036 Chromosome and associated proteins [BR:gmu03036]
    124876349 (skp1)
Membrane trafficking [BR:gmu04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    124876349 (skp1)
Ubiquitin system [BR:gmu04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     124876349 (skp1)
   Cul7 complex
     124876349 (skp1)
Chromosome and associated proteins [BR:gmu03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     124876349 (skp1)
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     124876349 (skp1)
SSDB
Motif
Pfam: Skp1 Skp1_POZ
Other DBs
NCBI-GeneID: 124876349
NCBI-ProteinID: XP_047234975
LinkDB
Position
11:12666500..12674208
AA seq 163 aa
MPTIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
NT seq 492 nt   +upstreamnt  +downstreamnt
atgcccacgataaaactacagagctctgatggggaaatctttgaggtggacgttgagata
gccaaacagtccgtcaccatcaagaccatgttagaagatttgggaatggacgatgaagga
gatgatgacccagtccccctccctaatgtgaatgctgccatcctcaagaaggtgattcag
tggtgtactcatcacaaagatgatccccctccccccgaggacgacgagaacaaggagaag
aggacggatgacattcctgtttgggaccaggagttcctcaaagtggaccaaggcaccttg
tttgaactcattctggccgctaactatttggacatcaaaggcctcttagatgtcacctgc
aagacggtggccaacatgatcaaaggcaaaaccccagaggagatcaggaagactttcaac
atcaaaaatgatttcacagaggaggaggaggcccaggtacgcaaagagaaccagtggtgt
gaagaaaaataa

DBGET integrated database retrieval system