Galleria mellonella (greater wax moth): 113510731 Help Entry 113510731         CDS       T09996                                  Name (RefSeq) GTPase HRas   KO K07827   GTPase KRas Organism gmw  Galleria mellonella (greater wax moth) Pathway gmw04013   MAPK signaling pathway - fly gmw04068   FoxO signaling pathway gmw04137   Mitophagy - animal gmw04140   Autophagy - animal gmw04150   mTOR signaling pathway gmw04213   Longevity regulating pathway - multiple species gmw04214   Apoptosis - fly gmw04320   Dorso-ventral axis formation Brite KEGG Orthology (KO) [BR:gmw00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     113510731    04068 FoxO signaling pathway     113510731    04150 mTOR signaling pathway     113510731  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     113510731    04137 Mitophagy - animal     113510731   09143 Cell growth and death    04214 Apoptosis - fly     113510731  09150 Organismal Systems   09158 Development and regeneration    04320 Dorso-ventral axis formation     113510731   09149 Aging    04213 Longevity regulating pathway - multiple species     113510731  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gmw04131]     113510731   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:gmw04031]     113510731 Membrane trafficking [BR:gmw04131]  Endocytosis   Macropinocytosis    Ras GTPases     113510731 GTP-binding proteins [BR:gmw04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     113510731 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf MMR_HSR1 RsgA_GTPase Septin FeoB_N Motif Other DBs NCBI-GeneID:  113510731 NCBI-ProteinID:  XP_026750045 UniProt:  A0A6J1WHY8 LinkDB All DBs Position Unknown AA seq 191 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLLVFAVNSAKSFEDIGSYREQIKRVKDAEEVPMVLVGNKCDL QAWAVDMTQAREVARSYDVPFVETSAKTRMGVDDAFYTLVREIRKDKESRGKKYRRGNKR GTRAPFKCILL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaaattggtggtggtaggtgctggaggcgtcggtaaatccgcattgact atacaacttatacaaaatcattttgtggacgagtatgatcctactattgaggattcgtat aggaaacaagtggtgattgatggtgaaacgtgcttactggatattctcgatacggctggt caagaggagtattccgcaatgagggatcaatacatgcggacgggggaagggttcctgctg gtgtttgcggtgaacagtgctaaaagtttcgaggacattggctcgtatcgagagcaaatc aaacgcgtcaaggacgcggaagaagtgcccatggtgctggtgggtaacaagtgtgaccta caggcgtgggctgtcgacatgacacaagcacgagaagtggcgcggagttacgacgtaccc tttgtggagacatcggccaagacgcggatgggagtcgacgacgccttctacaccctagtc cgcgaaatccgcaaggacaaagagagccgcggcaaaaaatataggagaggaaacaaaagg ggcacccgggccccgttcaagtgcatactactgtaa

DBGET integrated database retrieval system