Galleria mellonella (greater wax moth): 113518843 Help Entry 113518843         CDS       T09996                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism gmw  Galleria mellonella (greater wax moth) Pathway gmw04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:gmw00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     113518843  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:gmw04121]     113518843    03400 DNA repair and recombination proteins [BR:gmw03400]     113518843 Ubiquitin system [BR:gmw04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      113518843    Cul5 complex      113518843 DNA repair and recombination proteins [BR:gmw03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      113518843 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  113518843 NCBI-ProteinID:  XP_026759651 UniProt:  A0A6J1X1S5 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MDVFLMIRRKKLTIFTDAKDTTTVLELKKMIEGILKVPPASQMLFNKDSQLMEDETTLAE YGLTSATAKAQCPAPIGLALRKDNGEFEALDLTPYSSPPDLPDVMKSQETNGQEQMDQH NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtctttctaatgattaggcgaaaaaaattaaccattttcacagacgccaaggat acaacaacagtattagaattgaagaaaatgatcgaaggtatcctgaaagtgccaccagcg agccagatgctgttcaacaaagacagtcagctcatggaagatgagacaaccctcgcagag tatggactcacatcagccaccgccaaagctcagtgccctgcacctattggattggctttg aggaaggataatggcgaatttgaggccctggatttgactccatactcatcacccccagac ctccctgatgtaatgaagtctcaagagaccaatggacaggaacagatggatcagcattaa

DBGET integrated database retrieval system