Galleria mellonella (greater wax moth): 113520338 Help Entry 113520338         CDS       T09996                                  Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism gmw  Galleria mellonella (greater wax moth) Pathway gmw04814   Motor proteins Brite KEGG Orthology (KO) [BR:gmw00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     113520338  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:gmw03037]     113520338    04812 Cytoskeleton proteins [BR:gmw04812]     113520338 Cilium and associated proteins [BR:gmw03037]  Motile cilia and associated proteins   Dynein arm    113520338 Cytoskeleton proteins [BR:gmw04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      113520338 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  113520338 NCBI-ProteinID:  XP_026761451 UniProt:  A0A6J1WXR8 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MEVKECNDLSEENQFIVDDVSKIIKEAIENSIGGTAYQHNKVNQWTSAVVESCLGQLTKL QKPYKYIVTCTIMQKNGAGLHTASSCFWDNNTDGSCTVRWENKTMYCIVSVFGLGI NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggaggtgaaagaatgcaatgacctttctgaggaaaatcaatttattgttgacgatgta agcaaaattattaaagaagctattgaaaattcaatcggtggtactgcatatcaacataat aaagtcaatcagtggacatctgccgtagtggaatcttgtttgggtcaattgacgaaactg caaaagccttacaaatatatagtgacgtgcacaataatgcaaaaaaatggtgcagggctt cacacagcctcctcttgcttctgggacaacaatacggatggttcatgcactgtgcgctgg gaaaacaaaactatgtattgtattgtttctgtatttggcctcggcatctaa

DBGET integrated database retrieval system