Galleria mellonella (greater wax moth): 113523258 Help Entry 113523258         CDS       T09996                                  Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism gmw  Galleria mellonella (greater wax moth) Pathway gmw03030   DNA replication gmw03082   ATP-dependent chromatin remodeling gmw03410   Base excision repair gmw03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:gmw00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     113523258    03410 Base excision repair     113523258    03420 Nucleotide excision repair     113523258   09126 Chromosome    03082 ATP-dependent chromatin remodeling     113523258  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:gmw03032]     113523258    03036 Chromosome and associated proteins [BR:gmw03036]     113523258    03400 DNA repair and recombination proteins [BR:gmw03400]     113523258 Enzymes [BR:gmw01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      113523258 DNA replication proteins [BR:gmw03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     113523258 Chromosome and associated proteins [BR:gmw03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     113523258 DNA repair and recombination proteins [BR:gmw03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       113523258 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone TAF Motif Other DBs NCBI-GeneID:  113523258 NCBI-ProteinID:  XP_026764951 UniProt:  A0A6J1X515 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MAEKLEDLNLPLTVVTRIVKEALPEGATISKEARTGLAKAASVFVLYVTSAATNIVKNKK RKALTGQDVLDAMKDIEFDRFVEPLGEAFEQYKLVISARKSGAGKKKDEEEIETIEDD NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggcagagaaattagaagatttaaatcttcccttaactgttgtaactcgcatagtaaag gaagctttaccggagggagccacaatatccaaagaagctcgcacggggttagcgaaagcc gcctcagttttcgtcttatatgtgacttctgccgcaacaaatattgttaaaaacaagaaa aggaaagcattaaccgggcaggatgtgttagacgccatgaaagatatagaattcgacaga tttgtagagccattgggtgaggcatttgaacaatacaaattggtaatttccgcgcgaaaa tctggtgccggcaaaaagaaagacgaagaggagatagaaacgatagaagacgattag

DBGET integrated database retrieval system