Glycine max (soybean): 100301894 Help Entry 100301894         CDS       T01710                                  Symbol ATG8i Name (RefSeq) autophagy-related protein 8i   KO K08341   GABA(A) receptor-associated protein Organism gmx  Glycine max (soybean) Pathway gmx04136   Autophagy - other Brite KEGG Orthology (KO) [BR:gmx00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     100301894 (ATG8i)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gmx04131]     100301894 (ATG8i)    04121 Ubiquitin system [BR:gmx04121]     100301894 (ATG8i)    03029 Mitochondrial biogenesis [BR:gmx03029]     100301894 (ATG8i) Membrane trafficking [BR:gmx04131]  Autophagy   Autophagosome formation proteins    Atg8 conjugation proteins     100301894 (ATG8i) Ubiquitin system [BR:gmx04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    100301894 (ATG8i) Mitochondrial biogenesis [BR:gmx03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     100301894 (ATG8i) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATG8 APG12 RAWUL Motif Other DBs NCBI-GeneID:  100301894 NCBI-ProteinID:  NP_001235960 UniProt:  B9A7M1 LinkDB All DBs Position 2:882727..884158 Genome browser AA seq 122 aa AA seqDB search MGGSSSFRDEYTLEQRLGESRDIVAKYPDRVPVIVERYAKCDLPELEKKKYLVPRDLSVG HFIHILSSRLSLPPGKALFVFVKNTLPQTANMMDSVYRSFKDEDGFLYMYYSTEKTFGSY IM NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgggaggaagttcgagcttcagggatgagtataccttggaacaaaggctcggagaatcg cgggatattgtggccaaatatcccgatcgagtccccgtgattgtggaaagatatgcgaaa tgcgatctgcctgagttggagaagaaaaaataccttgttcctcgagacttgtctgttggg catttcattcatattttgagttccagacttagtctgccccctgggaaagctctctttgta tttgtgaagaataccttgcctcaaactgctaatatgatggactctgtgtatagatcattc aaggatgaggatggatttctttacatgtattatagcaccgaaaaaacctttggttcgtac atcatgtaa

DBGET integrated database retrieval system