Glycine max (soybean): 100499774 Help Entry 100499774         CDS       T01710                                  Symbol ROP10 Name (RefSeq) Rho-related protein ROP10   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism gmx  Glycine max (soybean) Pathway gmx04145   Phagosome gmx04148   Efferocytosis gmx04620   Toll-like receptor signaling pathway gmx05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:gmx00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     100499774 (ROP10)    04148 Efferocytosis     100499774 (ROP10)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100499774 (ROP10)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     100499774 (ROP10)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gmx04131]     100499774 (ROP10)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gmx04147]     100499774 (ROP10)    04031 GTP-binding proteins [BR:gmx04031]     100499774 (ROP10) Membrane trafficking [BR:gmx04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     100499774 (ROP10)  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     100499774 (ROP10)   Macropinocytosis    Ras GTPases     100499774 (ROP10)  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     100499774 (ROP10) Exosome [BR:gmx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100499774 (ROP10)   Exosomal proteins of other body fluids (saliva and urine)    100499774 (ROP10)   Exosomal proteins of colorectal cancer cells    100499774 (ROP10)   Exosomal proteins of bladder cancer cells    100499774 (ROP10) GTP-binding proteins [BR:gmx04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     100499774 (ROP10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CYTH Motif Other DBs NCBI-GeneID:  100499774 NCBI-ProteinID:  NP_001235844 UniProt:  C6SWE5 LinkDB All DBs Position 4:complement(43418427..43422768) Genome browser AA seq 212 aa AA seqDB search MAAATAPRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGITVNLG LWDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENVLKKWIPELQHFAPGIPLVLVG TKLDLREDRHYMADHPGLVPVTTEQGEELRKHIGATYYIECSSKTQQNVKAVFDAAIRMV IKPPQKQNEKRKKKPRGCFLNVLCGRNIVRLK NT seq 639 nt NT seq  +upstreamnt  +downstreamnt atggctgctgcaactgccccaagattcatcaagtgtgtgaccgttggcgatggagctgta gggaagacctgcatgctcatttgctataccagcaacaaattccccacggactatatcccc actgtgtttgataatttcagtgcaaatgtggttgttgaaggcataactgtcaatttaggc ctttgggatacagctgggcaagaggattacaacaggctgaggcccttgagctacaggggg gcagatgtctttgtcttggctttttctttagttagtcgcgcaagctatgagaatgtgctg aagaagtggatccctgaactccagcattttgcccctggcatcccattggtattagttggc acaaaattggatctgcgcgaagacaggcactatatggctgatcatcctggcttggtgccc gtgactactgagcaaggtgaggaactccgtaaacatattggagctacctactatattgag tgcagctcaaaaactcagcagaatgtgaaggcagtttttgatgctgcgatcagaatggtc atcaagcctccacaaaagcaaaacgagaaaaggaagaaaaaaccacgtggctgtttccta aatgtcctctgtggaaggaacattgttcgtcttaagtga

DBGET integrated database retrieval system