Glycine max (soybean): 100500277 Help Entry 100500277         CDS       T01710                                  Name (RefSeq) dynein light chain 1-like   KO K10418   dynein light chain LC8-type Organism gmx  Glycine max (soybean) Pathway gmx04814   Motor proteins Brite KEGG Orthology (KO) [BR:gmx00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     100500277  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:gmx03037]     100500277    04812 Cytoskeleton proteins [BR:gmx04812]     100500277 Cilium and associated proteins [BR:gmx03037]  Motile cilia and associated proteins   Dynein arm    100500277 Cytoskeleton proteins [BR:gmx04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      100500277 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  100500277 NCBI-ProteinID:  NP_001235710 UniProt:  C6T184 LinkDB All DBs Position 8:complement(2976462..2977683) Genome browser AA seq 93 aa AA seqDB search MLEGKAMVKETDMSTKMQIHAMASASQALDLYDVYDCISIAAHIKKEFDSVYGNGWQCVV GSNFGCYFTHSSGTFIYFALATLNFLIFKGTSS NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgttggaaggaaaggctatggtgaaagaaacagacatgtcaaccaagatgcagatccat gccatggcctctgcttctcaggcccttgatctctacgatgtttatgattgcatctctatt gctgcccatatcaagaaggaatttgatagtgtgtacgggaatgggtggcaatgtgtggta ggatccaattttgggtgctatttcacccattcatcagggactttcatctattttgctctg gcgactcttaattttcttatcttcaagggaacatcttcttga

DBGET integrated database retrieval system