Glycine max (soybean): 100527158 Help Entry 100527158         CDS       T01710                                  Name (RefSeq) Rho-related protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism gmx  Glycine max (soybean) Pathway gmx04145   Phagosome gmx04148   Efferocytosis gmx04517   IgSF CAM signaling gmx04518   Integrin signaling gmx04620   Toll-like receptor signaling pathway gmx05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:gmx00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     100527158    04518 Integrin signaling     100527158  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     100527158    04148 Efferocytosis     100527158  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100527158  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     100527158  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gmx04131]     100527158   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gmx04147]     100527158    04031 GTP-binding proteins [BR:gmx04031]     100527158 Membrane trafficking [BR:gmx04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     100527158  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     100527158   Macropinocytosis    Ras GTPases     100527158  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     100527158 Exosome [BR:gmx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100527158   Exosomal proteins of other body fluids (saliva and urine)    100527158   Exosomal proteins of colorectal cancer cells    100527158   Exosomal proteins of bladder cancer cells    100527158 GTP-binding proteins [BR:gmx04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     100527158 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CYTH Motif Other DBs NCBI-GeneID:  100527158 NCBI-ProteinID:  NP_001235733 UniProt:  A0A0R0JIZ1 C6T3H0 LinkDB All DBs Position 6:15930395..15934790 Genome browser AA seq 212 aa AA seqDB search MASATAPRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGITVNLG LWDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENVLKKWIPELQHFAPGIPLVLVG TKLDLREDKHYMADHPSLVPVTTDQGEELRKHIGATYYIECSSKTQQNVKAVFDAAIRMV IKPPQKQNEKRKKKPRGCFLNVLCRRNIVRLK NT seq 639 nt NT seq  +upstreamnt  +downstreamnt atggcttccgcaactgccccaagattcatcaagtgcgtgaccgttggtgatggagctgta gggaagacctgcatgctcatttgctataccagcaacaaattccccacggactatatcccc actgtgtttgataatttcagtgcaaatgtggttgttgaaggcataactgtcaacttaggc ctttgggatacagctgggcaagaggattacaacaggctgaggcccttgagctacaggggg gcagatgtctttgtcttggctttttctttagttagtcgcgcgagctatgagaatgtgctg aagaagtggatccctgaactccagcattttgcccctggcatcccgttggtgttagttggc accaaattggatctacgagaagacaagcactacatggctgatcatcccagcttggtgcca gtgactactgatcaaggtgaggaactccgtaaacacattggagctacctactatattgag tgcagctcaaaaactcagcagaatgtgaaggcagtttttgatgctgctattagaatggtc atcaagcctccacaaaagcaaaacgagaaaagaaagaaaaaaccacgtggctgtttccta aacgtcctctgtcgaaggaacattgttcgccttaaatga

DBGET integrated database retrieval system