Glycine max (soybean): 100527464 Help Entry 100527464         CDS       T01710                                  Name (RefSeq) ROP GTPase family protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism gmx  Glycine max (soybean) Pathway gmx04145   Phagosome gmx04148   Efferocytosis gmx04620   Toll-like receptor signaling pathway gmx05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:gmx00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     100527464    04148 Efferocytosis     100527464  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100527464  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     100527464  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gmx04131]     100527464   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gmx04147]     100527464    04031 GTP-binding proteins [BR:gmx04031]     100527464 Membrane trafficking [BR:gmx04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     100527464  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     100527464   Macropinocytosis    Ras GTPases     100527464  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     100527464 Exosome [BR:gmx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100527464   Exosomal proteins of other body fluids (saliva and urine)    100527464   Exosomal proteins of colorectal cancer cells    100527464   Exosomal proteins of bladder cancer cells    100527464 GTP-binding proteins [BR:gmx04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     100527464 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  100527464 NCBI-ProteinID:  NP_001236429 UniProt:  C6T4E6 LinkDB All DBs Position 4:complement(1836907..1839749) Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLALWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKL DLREDKQFFMDHPGAVPITTAQGEELRKLIGAPAYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKKRKAQKACSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtgcgtcgaggttcattaagtgcgtcaccgtcggcgacggcgctgtcggcaaaacc tgcttgttgatttcctacaccagcaacacttttcccacggactacgtgcccacggttttt gacaatttcagtgctaatgttgtggtggatggaagcaccgtaaacttggcattgtgggat actgctggtcaggaagattataataggcttagacccttgagctatcgaggagctgatgtt tttatacttgccttttctctcataagcaaggctagctatgaaaatattgcaaagaagtgg atccctgaactaaggcattatgcccctggtgttccaataattctcgttggaacaaagtta gatcttcgggaagataagcaattttttatggaccaccctggtgcagtaccaattactaca gcacagggagaagaattaagaaaactgattggtgctcctgcctacatcgagtgtagttca aaaacacagcagaatgtgaaagccgtctttgacgctgccatcaaagtggttcttcaacca ccaaagcaaaagaaaaagaagagaaaggcacaaaaagcttgctcaatattgtga

DBGET integrated database retrieval system