Glycine max (soybean): 100791566 Help Entry 100791566         CDS       T01710                                  Name (RefSeq) Rho-related GTPase   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism gmx  Glycine max (soybean) Pathway gmx04145   Phagosome gmx04148   Efferocytosis gmx04517   IgSF CAM signaling gmx04518   Integrin signaling gmx04620   Toll-like receptor signaling pathway gmx05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:gmx00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     100791566    04518 Integrin signaling     100791566  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     100791566    04148 Efferocytosis     100791566  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100791566  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     100791566  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gmx04131]     100791566   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gmx04147]     100791566    04031 GTP-binding proteins [BR:gmx04031]     100791566 Membrane trafficking [BR:gmx04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     100791566  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     100791566   Macropinocytosis    Ras GTPases     100791566  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     100791566 Exosome [BR:gmx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100791566   Exosomal proteins of other body fluids (saliva and urine)    100791566   Exosomal proteins of colorectal cancer cells    100791566   Exosomal proteins of bladder cancer cells    100791566 GTP-binding proteins [BR:gmx04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     100791566 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU ParE-like_toxin Motif Other DBs NCBI-GeneID:  100791566 NCBI-ProteinID:  NP_001241937 UniProt:  A0A0R0FKH6 C6TF66 LinkDB All DBs Position 17:7165517..7169464 Genome browser AA seq 226 aa AA seqDB search MAATASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVENTTVNLGL WDTAGQEDYNRLRPLSYRGADVFVLAFSLVSHASYENVLKKWVPELQHFAPGVPVVLVGT KLDLREDKHYLADHPGLAPVTSEQGEELRKLVGATYYIECSSKTQQNVKSVFDAAIKVVI EPPQKHEKKKKPRRGCLLSVHFFHIITTPARETFLLVKRDRSLSVH NT seq 681 nt NT seq  +upstreamnt  +downstreamnt atggctgcaacagcttcaaggttcatcaagtgtgtgacagtcggggatggagctgtaggc aaaacttgcatgctcatttgctatacaagcaacaaattccccacggactatattccaacg gtgtttgataatttcagtgcaaatgtggttgttgaaaacacaactgtcaatttaggcctc tgggacactgctgggcaagaggattacaacaggctgaggccattgagctacaggggggca gatgtctttgtcttggctttctctttagttagccatgcaagctacgaaaatgtgttgaag aagtgggttcctgaactgcagcattttgctcctggtgtcccagtggtgctagttggcacc aaattggatcttcgagaagacaagcactatttggctgatcatcctggtctggcgcctgtg acttctgagcaaggtgaggaattgcgtaaactggtcggagctacgtattatatagagtgc agctcaaagactcagcagaatgtgaagtcagtttttgatgctgctatcaaggtggtcatc gagcctccacaaaaacatgagaagaagaaaaaaccacgtcgagggtgtctactgtcagta cacttttttcatatcataacaactcctgcacgtgaaactttcttacttgtgaaaagggat agatcattaagtgttcattga

DBGET integrated database retrieval system