Glycine max (soybean): 100793700 Help Entry 100793700         CDS       T01710                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism gmx  Glycine max (soybean) Pathway gmx04016   MAPK signaling pathway - plant gmx04070   Phosphatidylinositol signaling system gmx04075   Plant hormone signal transduction gmx04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:gmx00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     100793700    04070 Phosphatidylinositol signaling system     100793700    04075 Plant hormone signal transduction     100793700  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     100793700  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:gmx01009]     100793700   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gmx04131]     100793700    03036 Chromosome and associated proteins [BR:gmx03036]     100793700   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gmx04147]     100793700 Protein phosphatases and associated proteins [BR:gmx01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      100793700 Membrane trafficking [BR:gmx04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     100793700 Chromosome and associated proteins [BR:gmx03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      100793700 Exosome [BR:gmx04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    100793700 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF_EFCAB10_C EF-hand_11 UPF0154 DUF5580_M EFhand_Ca_insen Dockerin_1 RNA_pol_Rpb4 Caleosin MotA_activ FCaBP_EF-hand SPEF2_C SurA_N_3 PA_Ig-like Fe_hyd_lg_C DUF6279 PhageMin_Tail MecA_N Motif Other DBs NCBI-GeneID:  100793700 NCBI-ProteinID:  XP_003519492 UniProt:  Q6LEG8 Structure PDBPDBj LinkDB All DBs Position 2:complement(47685893..47688052) Genome browser AA seq 149 aa AA seqDB search MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgatcagctcaccgacgaacagatctccgagttcaaggaagccttcagcctcttc gacaaggacggggatggttgtattaccaccaaggaacttgggaccgtgatgcggtcactt ggccagaacccaactgaggcagagctgcaggacatgataaatgaggttgatgctgatggg aatggtaccattgatttcccagaattcctgaatctcatggctcgcaagatgaaagacact gattcagaggaggagctgaaggaggctttccgcgtgtttgacaaggatcagaatggcttc atctctgcagcggagctccgccatgtgatgaccaatctcggtgagaagctgaccgacgag gaagtcgatgagatgattcgcgaggctgacgttgatggtgatggtcagatcaactatgag gagtttgtcaaagtcatgatggccaagtga

DBGET integrated database retrieval system