Glycine max (soybean): 100797664 Help Entry 100797664         CDS       T01710                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism gmx  Glycine max (soybean) Brite KEGG Orthology (KO) [BR:gmx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:gmx03041]     100797664   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:gmx04052]     100797664 Spliceosome [BR:gmx03041]  Complex B   Other components    Complex B specific factors     100797664 Cytokines and neuropeptides [BR:gmx04052]  Neuropeptides   Unclassified    100797664 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 OTU1_UBXL Rad60-SLD Ubiquitin_4 Crinkler Motif Other DBs NCBI-GeneID:  100797664 NCBI-ProteinID:  NP_001347356 LinkDB All DBs Position 13:32825324..32826096 Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNDDDTIGDLKKLVAAQTGTRADKIRIQKWYTIYKDHITLKDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaggtggttttgaacgatcgattggggaagaaggtgcgcgtgaagtgcaacgac gatgataccatcggcgacctgaagaagcttgtggcggctcagactggcacaagagccgac aagatccgcatccagaagtggtacaccatctacaaggatcacatcactctcaaggattac gagatccatgacggcatgggtctcgaactctactacaactaa

DBGET integrated database retrieval system