Glycine max (soybean): 100809769 Help Entry 100809769         CDS       T01710                                  Name (RefSeq) SKP1-like protein 1A isoform X2   KO K03094   S-phase kinase-associated protein 1 Organism gmx  Glycine max (soybean) Pathway gmx03083   Polycomb repressive complex gmx04120   Ubiquitin mediated proteolysis gmx04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:gmx00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     100809769    04120 Ubiquitin mediated proteolysis     100809769   09126 Chromosome    03083 Polycomb repressive complex     100809769  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gmx04131]     100809769    04121 Ubiquitin system [BR:gmx04121]     100809769    03036 Chromosome and associated proteins [BR:gmx03036]     100809769 Membrane trafficking [BR:gmx04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     100809769 Ubiquitin system [BR:gmx04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      100809769    Cul7 complex      100809769 Chromosome and associated proteins [BR:gmx03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      100809769   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      100809769 SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ Methyltransf_16 Motif Other DBs NCBI-GeneID:  100809769 NCBI-ProteinID:  XP_003517160 UniProt:  A0A0R0LC97 LinkDB All DBs Position 1:complement(51257262..51259492) Genome browser AA seq 155 aa AA seqDB search MSSAKKITLKSSDGEAFEVDEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYC KKHVEAANPEDKPSEDDLKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI KGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcggcgaagaagatcacactgaagagttcggacggcgaggctttcgaggtggac gaggcggtggcgctggagtctcagacgataaagcacatgatcgaggacgactgcgccgac agcggcatccctctgccgaacgtgacgagcaagatcctggcgaaggtgatcgagtactgc aagaagcacgtcgaggccgcgaatcccgaagacaaaccctccgaggacgatctcaaagcc tgggacgccgatttcgtcaaggtcgaccaggccacgctcttcgatcttatcctggctgcg aactacttgaacatcaagagcctgctggaccttacatgccaaactgtagccgacatgatc aaggggaagactcccgaggaaattcgcaagacctttaacattaagaatgacttcacccct gaggaagaagaggaagttcgtcgggaaaatcaatgggcatttgaatga

DBGET integrated database retrieval system