Glycine max (soybean): 102666811 Help Entry 102666811         CDS       T01710                                  Name (RefSeq) calmodulin-1   KO K02183   calmodulin Organism gmx  Glycine max (soybean) Pathway gmx04016   MAPK signaling pathway - plant gmx04070   Phosphatidylinositol signaling system gmx04075   Plant hormone signal transduction gmx04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:gmx00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     102666811    04070 Phosphatidylinositol signaling system     102666811    04075 Plant hormone signal transduction     102666811  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     102666811  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:gmx01009]     102666811   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gmx04131]     102666811    03036 Chromosome and associated proteins [BR:gmx03036]     102666811   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gmx04147]     102666811 Protein phosphatases and associated proteins [BR:gmx01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      102666811 Membrane trafficking [BR:gmx04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     102666811 Chromosome and associated proteins [BR:gmx03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      102666811 Exosome [BR:gmx04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    102666811 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 CFAP251_C EF-hand_FSTL1 EH Allatotropin-like_C SPARC_Ca_bdg EF_EFCAB10_C EF-hand_11 UPF0154 SAPC2_N DUF5580_M Dockerin_1 EFhand_Ca_insen EF-hand_EFHB_C Caleosin FCaBP_EF-hand EF-hand_STIM1 SPEF2_C PA_Ig-like SurA_N_3 DUF6279 MecA_N Motif Other DBs NCBI-GeneID:  102666811 NCBI-ProteinID:  XP_040869535 UniProt:  C6TDT8 LinkDB All DBs Position 20:9486435..9488792 Genome browser AA seq 149 aa AA seqDB search MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgaccagctcaccgacgaccagatcgccgagttcaaggaggccttcagcctcttc gacaaggacggcgatggttgcattactaccaaggaacttgggactgttatgaggtcactt ggtcaaaacccaactgaggcagaactgcaggatatgataaacgaggttgatgctgatggc aacggaaccatcgatttcccagagttcctcaacctgatggctcgcaagatgaaagacacc gactcagaggaggagcttaaggaggctttccgtgtgtttgacaaggatcagaatggtttc atctctgcagctgagctccgccatgtcatgacaaatcttggggagaagctgacggacgag gaggtggatgagatgatccgtgaggccgatgttgacggtgatggacagatcaactatgag gagtttgtcaaagtcatgatggccaagtga

DBGET integrated database retrieval system