KEGG   Geomonas diazotrophica: KP003_02035
Entry
KP003_02035       CDS       T07937                                 
Name
(GenBank) response regulator
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
gnt  Geomonas diazotrophica
Pathway
gnt02020  Two-component system
gnt02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:gnt00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KP003_02035
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    KP003_02035
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:gnt02022]
    KP003_02035
   02035 Bacterial motility proteins [BR:gnt02035]
    KP003_02035
Two-component system [BR:gnt02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   KP003_02035
Bacterial motility proteins [BR:gnt02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    KP003_02035
SSDB
Motif
Pfam: Response_reg
Other DBs
NCBI-ProteinID: QXE87208
LinkDB
Position
complement(466820..467185)
AA seq 121 aa
MALKVMIVDDSLFMRKMLRDILVEEGYEIADEASDGVEAVAKYKECLPDLVTLDIVMPNK
TGIEALQEIMAYDAGARVVMCSAIGQEALTTAATVAGAKAFILKPFNPELVLRVLREVAQ
G
NT seq 366 nt   +upstreamnt  +downstreamnt
atggccttgaaggtcatgatagtggacgactccctgttcatgaggaaaatgctgcgcgac
atcctcgtggaagaggggtacgagatagccgacgaggcatccgatggcgtggaggcggtg
gcgaagtacaaggagtgcctccccgacctggtcaccctggacatcgtgatgcccaacaag
accggaatcgaggcgctgcaggagatcatggcctacgacgccggcgcccgcgtggtgatg
tgctccgccatcggccaggaggcgctcaccacggcggcgaccgtggccggcgccaaggcg
ttcatactgaagcccttcaaccccgagctggtgctccgggtgctcagggaagtggcccag
gggtaa

DBGET integrated database retrieval system