Geomonas nitrogeniifigens: KP003_04825 Help Entry KP003_04825       CDS       T07937                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gnt  Geomonas nitrogeniifigens Pathway gnt01100   Metabolic pathways gnt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gnt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KP003_04825 (acpP)    00074 Mycolic acid biosynthesis     KP003_04825 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KP003_04825 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF1493 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  QXE87732 LinkDB All DBs Position 1100565..1100798 Genome browser AA seq 77 aa AA seqDB search MASIEKRIKEIVAEQLGVDEAQVTNESSFMDDLGADSLDTVELVMALEEEFEIEISDEDA EKIQSVQDAIDYITDHT NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcttcgatcgagaaacgcattaaagagatagtagctgagcagcttggtgttgacgag gctcaggtgaccaacgagtcctccttcatggacgacctgggcgccgactccctggatacc gttgaactggtgatggcccttgaagaggaattcgaaatcgagatctccgacgaggacgcc gagaaaatccagtcggttcaggacgcaatcgactacatcactgatcacacctag

DBGET integrated database retrieval system