KEGG   Geodermatophilus obscurus: Gobs_3208
Entry
Gobs_3208         CDS       T01163                                 
Name
(GenBank) response regulator receiver and ANTAR domain protein
  KO
K22010  two-component system, response regulator PdtaR
Organism
gob  Geodermatophilus obscurus
Brite
KEGG Orthology (KO) [BR:gob00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:gob02022]
    Gobs_3208
Two-component system [BR:gob02022]
 Other families
  PdtaS-PdtaR
   Gobs_3208
SSDB
Motif
Pfam: Response_reg ANTAR Peripla_BP_2
Other DBs
NCBI-ProteinID: ADB75813
UniProt: D2S9L3
LinkDB
Position
complement(3366724..3367326)
AA seq 200 aa
MSSEPIRVLIAEDEALIRLDLKEMLEEEGYTVVAEAGDGQQAVEQATELRPDLVILDIQM
PVLDGLSAAEQIASARIAPVIVLTAFSQRELVERARDAGAMAYLVKPFSKNDLVPAIEVA
RGRYAEMTALDGEVRTLEERLETRKVVEQAKGKLMTDQGMTEAEAFRFIQRTAMNERTSM
KALAQRILQPEAAADPTTGS
NT seq 603 nt   +upstreamnt  +downstreamnt
gtgagcagcgagccgatccgggtcctcatcgccgaagacgaggcgctcatccgcctcgac
ctcaaggagatgctcgaggaggaggggtacaccgtcgtggccgaggccggcgacgggcag
caggccgtcgagcaggccaccgagctgcggccggacctggtgatcctggacatccagatg
ccggtactcgacgggctctcggccgccgagcagatcgcctcggcccgcatcgcgccggtc
atcgtgctgaccgccttcagccagcgcgagctggtcgagcgggcgcgcgacgccggtgcc
atggcctatctggtcaagccgttctccaagaacgacctggtgccggccatcgaggtggcc
cgtggccgctacgccgagatgaccgccctcgacggcgaggtacgcacgctcgaggagcgc
ctggagacccgcaaggtggtcgagcaggccaagggcaagctgatgaccgaccaggggatg
accgaggccgaggccttccggttcatccagcggacggcgatgaacgagcgcacgtcgatg
aaagcgctcgcccagcgcatcctgcagccggaggccgccgcggacccgacgacgggcagc
tga

DBGET integrated database retrieval system